PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_25753A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 284aa    MW: 29827.7 Da    PI: 7.8793
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_25753AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.4e-173881146
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                               rg+++++E+ l+++++++lG++ W+ Ia++++ gRt++++k++w++
  Oropetium_20150105_25753A 38 RGSFSQQEEALIIELHRMLGNR-WAQIAKHLP-GRTDNEVKNFWNS 81
                               899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-111844IPR009057Homeodomain-like
SuperFamilySSF466891.92E-211887IPR009057Homeodomain-like
PROSITE profilePS500904.0541932IPR017877Myb-like domain
PROSITE profilePS5129426.8283387IPR017930Myb domain
SMARTSM007174.5E-173785IPR001005SANT/Myb domain
PfamPF002496.7E-163881IPR001005SANT/Myb domain
CDDcd001671.14E-124080No hitNo description
Gene3DG3DSA:1.10.10.603.1E-214584IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MSMHTTKASA AVLQSGLQRC GKSCRLRWIN YLRPDLKRGS FSQQEEALII ELHRMLGNRW  60
AQIAKHLPGR TDNEVKNFWN STIKKKLISQ AVGKLHPGNV PSPADLYYNI LDGAAGHGMA  120
AAGCAPLHGA GNAPSQSVST PSPSSMVHNP AAWVDFGSQP FLLPVHGGGD LQYGVDGEFV  180
KLCRAADAYP PENGGASIAA VQCKRAADNA DLVTQEGAAV RSLPAAFLEP KGAGSCFAAE  240
QAMGPVVDFM ETILGSSSTS AVSASTVDSF STNTGMQPHS WIP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25198740108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3729262e-96AK372926.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3016B12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969713.11e-123PREDICTED: myb-related protein Hv1-like isoform X1
TrEMBLK3XK961e-122K3XK96_SETIT; Uncharacterized protein
STRINGSi002319m1e-121(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128133035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.22e-44myb domain protein 26